DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and Aldh8a1

DIOPT Version :9

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_848828.1 Gene:Aldh8a1 / 237320 MGIID:2653900 Length:487 Species:Mus musculus


Alignment Length:402 Identity:100/402 - (24%)
Similarity:178/402 - (44%) Gaps:37/402 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 IQMAIDKSVEAQVKWDKVRLSDRIDIWERAAMLIAGRYRYNIIAATMLGQGKTLRQAE-MDVAEL 183
            |:.|::.:.||...|......:|..:..|.|.::..... .:..|....|||||..|. ||:...
Mouse    47 IEAAVEAAREAFPAWSSRSPQERSLVLNRLADVLEQSLE-ELAQAESKDQGKTLTLARTMDIPRS 110

  Fly   184 V----DFMRINPVFLRELANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTGIAANLAYTPAL 244
            |    .|...|...:.|......:..:....|..:.:.||      |||:|...........||:
Mouse   111 VLNFRFFASSNLHHVSECTQMSHLGCMHYTVRTPVGIAGL------ISPWNLPLYLLTWKIAPAI 169

  Fly   245 -MGNSVIWKPSDSAILSNYFVFKALREAGVPDGVVNFVPAEETTFASVVTQHPKLAGINFTGTST 308
             .||:||.|||:...::.:...|.|.:||||.||:|.|..........:..||::..|:|||:..
Mouse   170 AAGNTVIAKPSEMTSVTAWMFCKLLDKAGVPPGVINIVFGTGPRVGEALVSHPEVPLISFTGSQP 234

  Fly   309 VLKVLWQLVAQNINFYQNYPRLVGEGGGKNFHFVHSSAEPETAVACTIRAAFEYAGQKCSSCSML 373
            ..:.:.||.|.:..      :|..|.||||...:...|..|..:..|:|::|...|:.|...|.:
Mouse   235 TAERITQLSAPHCK------KLSLELGGKNPAIIFEDANLEECIPATVRSSFANQGEICLCTSRI 293

  Fly   374 YVPESLWQNHIREPLLEITA--SLVVRQDATYCDSFCSAVINRRAYDRIYMWLRYIDQSPSCQIL 436
            :|..|::...::. .:|.|.  .:.|..|.:   :...|:|::...:::..::... |:...:||
Mouse   294 FVQRSIYSEFLKR-FVEATRKWKVGVPSDPS---ANMGALISKAHLEKVRSYVLKA-QTEGARIL 353

  Fly   437 VGGSCDK-------RRGYYVDPTVVL-VKDLDNIICREELLAPILGVYVYPDHKLKETMEKVAQI 493
            .|...|:       :.||::.|||:. :|| ::....||:..|:  ..|.|....:|.:.:...:
Mouse   354 CGEGVDQLSLPLRNQAGYFMLPTVITDIKD-ESRCMTEEIFGPV--TCVVPFDSEEEVITRANSV 415

  Fly   494 NHGLTGSVFAQD 505
            .:||..:|:::|
Mouse   416 RYGLAATVWSKD 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 100/402 (25%)
Aldh8a1NP_848828.1 ALDH_F8_HMSADH 27..485 CDD:143412 100/402 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.