DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P5CDh2 and ALDH16A1

DIOPT Version :9

Sequence 1:NP_788705.1 Gene:P5CDh2 / 32625 FlyBaseID:FBgn0053092 Length:614 Species:Drosophila melanogaster
Sequence 2:NP_699160.2 Gene:ALDH16A1 / 126133 HGNCID:28114 Length:802 Species:Homo sapiens


Alignment Length:419 Identity:86/419 - (20%)
Similarity:152/419 - (36%) Gaps:89/419 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 KTLRQAEMDVA-ELVDFMRINPVFLRE-LANYEPIRDIQNNCRNSMRLRGLSGFVAAISPFNFTG 233
            :.:|..::.:| :|:.:..|......| ||.:||:                 |.:..|.|..|:.
Human   132 REVRDGDVQLAQQLLHYHAIQASTQEEALAGWEPM-----------------GVIGLILPPTFSF 179

  Fly   234 IAANLAYTPAL-MGNSVI--WKPSDSAILSNYFVFKALREAGVPDGVVNFV--PAEETTFASVVT 293
            :.......||| :|.:|:  ..|:..|.|   .:.:...|.|...|::|.:  ||   :...::.
Human   180 LEMMWRICPALAVGCTVVALVPPASPAPL---LLAQLAGELGPFPGILNVLSGPA---SLVPILA 238

  Fly   294 QHPKLAGINFTGTSTVLKVLWQLVAQNINFYQNYPRLVGEG-------GGKNFHFVHSSAEPETA 351
            ..|.:..:.|.|.....:.|.:             .|.||.       |.::...:..:|:.::|
Human   239 SQPGIRKVAFCGAPEEGRALRR-------------SLAGECAELGLALGTESLLLLTDTADVDSA 290

  Fly   352 VACTIRAAFEYAGQKCSSCSMLYVPESLWQNHIREPLLEITASL-----------VVRQDATYCD 405
            |...:.||:...|   .....|.:.||:|...:|. |.|....|           :..:.|..||
Human   291 VEGVVDAAWSDRG---PGGLRLLIQESVWDEAMRR-LQERMGRLRSGRGLDGAVDMGARGAAACD 351

  Fly   406 SFCSAVINRRAYDRIYMWLRYIDQSPSCQILVGGSCDKRRGYYVDPTVVLVKDLDNIICREELLA 470
                 ::.|...:.         ||...|:...|.....|.:| .||  ||.:|.......::..
Human   352 -----LVQRFVREA---------QSQGAQVFQAGDVPSERPFY-PPT--LVSNLPPASPCAQVEV 399

  Fly   471 PILGVYVYPDHKLKETMEKVAQINHGLTGSVFAQDQNFIEEAYD-AFRVNVGNLNVNDKSTGLMV 534
            |...|...|....||.:........|.:.||:::.   :.:|.: .:.:.||.:.:|  :.||..
Human   400 PWPVVVASPFRTAKEALLVANGTPRGGSASVWSER---LGQALELGYGLQVGTVWIN--AHGLRD 459

  Fly   535 GQQPFGAGHMTGTSDKLGTPHSLLRWTSP 563
            ...|.|....:|.|.. |.|..|..:..|
Human   460 PSVPTGGCKESGCSWH-GGPDGLYEYLRP 487

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P5CDh2NP_788705.1 ALDH-SF 50..570 CDD:299846 86/419 (21%)
ALDH16A1NP_699160.2 ALDH-SF 19..492 CDD:299846 86/419 (21%)
ALDH-SF 527..>765 CDD:299846
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1012
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.