DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33056 and POA1

DIOPT Version :9

Sequence 1:NP_788556.1 Gene:CG33056 / 326246 FlyBaseID:FBgn0053056 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_009578.1 Gene:POA1 / 852310 SGDID:S000000226 Length:177 Species:Saccharomyces cerevisiae


Alignment Length:170 Identity:35/170 - (20%)
Similarity:63/170 - (37%) Gaps:55/170 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 ITEARGNLFSAPENYA--LVHSVSADFAMCAGINLQFRCKFGQVDELKRQHKHTGNVAVLEQDGR 223
            ||..:||:.. |::||  |:||.:.:.:...||..|...::.:.::        ..|.|.|:.|.
Yeast     4 ITYVKGNILK-PKSYARILIHSCNCNGSWGGGIAYQLALRYPKAEK--------DYVEVCEKYGS 59

  Fly   224 HIYNLVTKERSHEK------CTYAA-------------LYYALLAM------RE----------- 252
            ::........|:|.      |.:.:             |.|..||:      ||           
Yeast    60 NLLGKCILLPSYENSDLLICCLFTSSFGGSSHGEKQSILNYTKLALDKLKTFREAKDKTRTSEDS 124

  Fly   253 ---HMREH-----GVTKLAIPRLGCGIDRLDWLRVRSLLD 284
               ::..|     |..||.:|::..||..:.|.....:|:
Yeast   125 IGDYLNGHIKYPIGEYKLEMPQINSGIFGVPWKETERVLE 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33056NP_788556.1 Macro_Poa1p_like 5..136 CDD:239230
Macro_Poa1p_like 160..289 CDD:239230 35/170 (21%)
POA1NP_009578.1 YmdB 1..174 CDD:225021 35/170 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12521
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.