DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33056 and Oard1

DIOPT Version :9

Sequence 1:NP_788556.1 Gene:CG33056 / 326246 FlyBaseID:FBgn0053056 Length:343 Species:Drosophila melanogaster
Sequence 2:NP_001128068.1 Gene:Oard1 / 367214 RGDID:1308299 Length:158 Species:Rattus norvegicus


Alignment Length:141 Identity:37/141 - (26%)
Similarity:61/141 - (43%) Gaps:35/141 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 QITEARGNLFSAPENYALVHSVSADFAMCAGINLQFRCKFGQVDELKRQHKH------TGNVAVL 218
            :||..:|:||:.|:..:|.|.:|.|..|.|||.:.|:.:||.|.||..|...      :|.:.: 
  Rat    13 RITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKRFGGVQELLSQRLDAVWIVCSGKMYL- 76

  Fly   219 EQDGRHIYNLVTKERSHEKCTYAALYYALLAMREHMREHGVTKLAIPRLGC--GIDRLDWLRVRS 281
                :.:...::::.|...||::          |.::..|..| ||...|.  .....:|     
  Rat    77 ----QFLKRCLSQQTSRLPCTHS----------EQVKMLGEPK-AIYEAGAPSSCTTSEW----- 121

  Fly   282 LLDLVFAEDSV 292
                  |||||
  Rat   122 ------AEDSV 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33056NP_788556.1 Macro_Poa1p_like 5..136 CDD:239230
Macro_Poa1p_like 160..289 CDD:239230 32/136 (24%)
Oard1NP_001128068.1 Macro 14..>62 CDD:294024 20/47 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339507
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_29TCN
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1416296at2759
OrthoFinder 1 1.000 - - FOG0006886
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108279
Panther 1 1.100 - - O PTHR12521
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.