DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gorab and GORAB

DIOPT Version :9

Sequence 1:NP_788523.1 Gene:Gorab / 326245 FlyBaseID:FBgn0053052 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_011508451.1 Gene:GORAB / 92344 HGNCID:25676 Length:377 Species:Homo sapiens


Alignment Length:321 Identity:85/321 - (26%)
Similarity:147/321 - (45%) Gaps:92/321 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRMPDKIFRQADQLRK---QQQQQ-----------PQQ----PIQKPDVAKKTKSGTATPTEKPP 91
            ||:|.|..||..|..|   :|.|:           |:|    |.|:.:|            :|||
Human    35 RRLPAKKSRQQLQREKALVEQSQKLGLQDGSTSLLPEQLLSAPKQRVNV------------QKPP 87

  Fly    92 TPTPAAEDDVANGSLNLDRPLSDSLIEALYHGNATARDKKTPATYADAETTSTDDSSILKISGGD 156
            ..:|...     ....|..|:.|.                                   :..|.:
Human    88 FSSPTLP-----SHFTLTSPVGDG-----------------------------------QPQGIE 112

  Fly   157 SQT----TSSTDDG----SILPSTQDTSPRERLNTDSPFKGISLKD------FEQHRRMIEEQNK 207
            ||.    ..::.||    .|||...|....:        |.:.|::      .:|.:|::||:||
Human   113 SQPKELGLENSHDGHNNVEILPPKPDCKLEK--------KKVELQEKSRWEVLQQEQRLMEEKNK 169

  Fly   208 QKKQMLYQAIEQHTQKTAAESRKIEEIRHELSKLESDLAVDVALLRKQIDNACIHFANVEKQYVK 272
            :||.:|.:||.:.:::|.||:.|::.|:.||..|:..::.|:.:||.:||.|.:.::...|::.:
Human   170 RKKALLAKAIAERSKRTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLDYSYARKRFDR 234

  Fly   273 IEAQFLRAKIELHNASEKKELLTEHLCTVIAHNEDRKAQKLTELMQKVGLSPTDDCQPIDL 333
            .||:::.||:::...:|.||.|||||||:|..||.|||:||.||||::.:...::...:::
Human   235 AEAEYIAAKLDIQRKTEIKEQLTEHLCTIIQQNELRKAKKLEELMQQLDVEADEETLELEV 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GorabNP_788523.1 Transcrip_act <200..316 CDD:309879 47/115 (41%)
GORABXP_011508451.1 Transcrip_act <162..283 CDD:282763 51/120 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165146838
Domainoid 1 1.000 111 1.000 Domainoid score I6290
eggNOG 1 0.900 - - E1_28Z6D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277705at2759
OrthoFinder 1 1.000 - - FOG0007411
OrthoInspector 1 1.000 - - oto88826
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21470
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5201
SonicParanoid 1 1.000 - - X5537
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.840

Return to query results.
Submit another query.