DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gorab and AT3G52920

DIOPT Version :9

Sequence 1:NP_788523.1 Gene:Gorab / 326245 FlyBaseID:FBgn0053052 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_566974.1 Gene:AT3G52920 / 824458 AraportID:AT3G52920 Length:180 Species:Arabidopsis thaliana


Alignment Length:156 Identity:34/156 - (21%)
Similarity:75/156 - (48%) Gaps:11/156 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 TSPRERLNTDSPFKGISLKDFEQHR------RMIEEQNKQKKQMLYQAIEQHTQKTAAESRKIEE 233
            |.|.:::.:.|....:|.:|.|..|      |..|::.:::|..:.:.::....:...|:|::..
plant     9 TQPPQQMMSLSFSSQMSKEDEEMARSALSAFRAKEDEIEKRKMEVRERVKAQLGRVEEETRRLAS 73

  Fly   234 IRHELSKLESDLAVDVALLRKQIDNACIHFANVEKQYVKIEAQFLRAKIELHNAS--EKKELLTE 296
            ||.||..:...:..:|..:||:||:.......:.....|.|.::..| ::..|..  ||.:|:|:
plant    74 IREELETMADPMRKEVNWVRKKIDSVNKELKPLGSTVQKKEREYKEA-LDTFNEKNREKVQLITK 137

  Fly   297 --HLCTVIAHNEDRKAQKLTELMQKV 320
              .:..::..:|..:.:||.||.:.:
plant   138 LMEMGQLVGESEKLRLKKLDELSRSI 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GorabNP_788523.1 Transcrip_act <200..316 CDD:309879 25/119 (21%)
AT3G52920NP_566974.1 Transcrip_act 22..165 CDD:398553 31/143 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_124332
Panther 1 1.100 - - O PTHR21470
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.