DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gorab and AT3G52900

DIOPT Version :9

Sequence 1:NP_788523.1 Gene:Gorab / 326245 FlyBaseID:FBgn0053052 Length:338 Species:Drosophila melanogaster
Sequence 2:NP_190858.1 Gene:AT3G52900 / 824456 AraportID:AT3G52900 Length:164 Species:Arabidopsis thaliana


Alignment Length:166 Identity:37/166 - (22%)
Similarity:77/166 - (46%) Gaps:10/166 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 TSSTDDGSILPSTQDTS---PRERLNTDSPFKGISLKDFEQHRRMIEEQNKQKKQMLYQAIEQHT 221
            :|..:.|:...|..:|:   |.|. |.:.....:::..|:..    ||:.::||..:.:.::|..
plant     2 SSKNNSGAAAVSGVNTNGKLPMED-NEEEEIWKVAVTRFQAR----EEEIERKKMTVKEKVQQRL 61

  Fly   222 QKTAAESRKIEEIRHELSKLESDLAVDVALLRKQIDNACIHFANVEKQYVKIEAQFLRAKIELHN 286
            ......:|.:.:...||..:...:..:|.::||:||.|.....::.:...|.|.:: :..:|..|
plant    62 GFAEEATRCLTQTLEELEIMGDPMRKEVGMVRKKIDMANRDIKSLAQSCQKKEKEY-KDTLEAFN 125

  Fly   287 ASEK-KELLTEHLCTVIAHNEDRKAQKLTELMQKVG 321
            ...| |..|...|..::|.:|..:.:||.|:.:.||
plant   126 EKNKEKAHLVSMLMELLAESERLRIKKLEEINKTVG 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GorabNP_788523.1 Transcrip_act <200..316 CDD:309879 26/116 (22%)
AT3G52900NP_190858.1 Transcrip_act 13..162 CDD:398553 35/155 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21470
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.