DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gorab and Gorab

DIOPT Version :9

Sequence 1:NP_788523.1 Gene:Gorab / 326245 FlyBaseID:FBgn0053052 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_038946710.1 Gene:Gorab / 304923 RGDID:1564990 Length:381 Species:Rattus norvegicus


Alignment Length:306 Identity:91/306 - (29%)
Similarity:151/306 - (49%) Gaps:62/306 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 RRMPDKIFRQADQLRKQQQQQPQQ-PIQKPDVAKKTKSGTATP-----TEKPPTPTPAAEDDVAN 103
            ||:|.|..||..|..|...:|.|: .:|....:...:...:||     ::|||..:||.      
  Rat    40 RRLPVKKTRQQLQREKALLEQSQKLGLQDGSASLLPEQLLSTPKQRASSQKPPPSSPAV------ 98

  Fly   104 GSLNLDRPLSDSLIEALYHGNATARDKKTPATYADAETTSTDDSSILKISGGDSQTTSSTDDGSI 168
                                       .:|.|.    |:||.|.   ::.||:||.   .:.|  
  Rat    99 ---------------------------PSPLTL----TSSTGDG---ELHGGESQL---QEPG-- 124

  Fly   169 LPSTQDTSPRERLNTDSPFKGISLKDFE-----------QHRRMIEEQNKQKKQMLYQAIEQHTQ 222
            |.::...|....:.|..|...:..|..|           |.:|::||:||:||.:|.|||.:.::
  Rat   125 LENSHHGSRSAEIQTPKPDCKVEKKKMELQEKSRWEVLQQEQRLMEEKNKRKKALLAQAIAERSR 189

  Fly   223 KTAAESRKIEEIRHELSKLESDLAVDVALLRKQIDNACIHFANVEKQYVKIEAQFLRAKIELHNA 287
            :|.||:.|::.|:.||..|:..::.|:.:||.:||.|.:.::...|::.:.||:::.||::|...
  Rat   190 RTQAETMKLKRIQKELQALDDMVSADIGILRNRIDQASLEYSYARKRFDRAEAEYVTAKLDLQRK 254

  Fly   288 SEKKELLTEHLCTVIAHNEDRKAQKLTELMQKVGLSPTDDCQPIDL 333
            :|.||.|||||||:|..||.||||||.|||:::.:...|:...::|
  Rat   255 TETKEQLTEHLCTIIQQNELRKAQKLEELMRQLDVQADDEALELEL 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GorabNP_788523.1 Transcrip_act <200..316 CDD:309879 50/115 (43%)
GorabXP_038946710.1 Transcrip_act <170..288 CDD:398553 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166340495
Domainoid 1 1.000 114 1.000 Domainoid score I5932
eggNOG 1 0.900 - - E1_28Z6D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 126 1.000 Inparanoid score I4598
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277705at2759
OrthoFinder 1 1.000 - - FOG0007411
OrthoInspector 1 1.000 - - oto95958
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR21470
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5537
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.860

Return to query results.
Submit another query.