DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gorab and gorab

DIOPT Version :9

Sequence 1:NP_788523.1 Gene:Gorab / 326245 FlyBaseID:FBgn0053052 Length:338 Species:Drosophila melanogaster
Sequence 2:XP_002933832.1 Gene:gorab / 100485483 XenbaseID:XB-GENE-951259 Length:363 Species:Xenopus tropicalis


Alignment Length:323 Identity:97/323 - (30%)
Similarity:160/323 - (49%) Gaps:55/323 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 GFSHDEILKITGVKEGGVGKRPASLEAAKPALRIQPGIRRMPDKIFRQADQLRKQQQQQPQQPIQ 71
            |||.:|:..:. .|:|          ...|....:|  ||.|......|.:.|:|.|::....:|
 Frog     6 GFSEEELRNLK-TKQG----------TDLPHHPDRP--RRQPTSAKPTAAKSRQQMQRKLALQVQ 57

  Fly    72 KPDVAKKTKSGTATPTEKPPTPTPAAEDDVANGSLNL--DRPLSDSLIEALYHGNATARDKKTPA 134
            ...:||:                        :|||.:  ::.||.|.|.:..:......:||  .
 Frog    58 SQLLAKQ------------------------DGSLCVPAEQQLSRSSITSSPNVITCPAEKK--Q 96

  Fly   135 TYADAETTSTDDSSILKISGGDSQTTSSTDDGSILPSTQDTSPRERLNTDSPFKGISLKDFEQHR 199
            ...|....||..|..:.:.|.|   ..|..||.:  :.:|...||:...|         ..:..:
 Frog    97 VIHDQPEMSTSVSPGIDLKGKD---LFSEQDGEL--NKKDMELREKSRLD---------QLQMEQ 147

  Fly   200 RMIEEQNKQKKQMLYQAIEQHTQKTAAESRKIEEIRHELSKLESDLAVDVALLRKQIDNACIHFA 264
            |::||:||:||.:|.:||.:.::||.||:.|:..|:.:|..|:..::.|:.:||.:||.||:.|:
 Frog   148 RLMEEKNKRKKALLAKAIAERSKKTQAEAVKLNRIQKQLQALDDLVSTDIGILRNRIDQACMEFS 212

  Fly   265 NVEKQYVKIEAQFLRAKIELHNASEKKELLTEHLCTVIAHNEDRKAQKLTELMQKVGLSPTDD 327
            ..:|:|.|.||:::.||::||..:|.||.|||||||:|..||.|||:||.||||::.:...::
 Frog   213 QAKKRYDKAEAEYILAKVDLHKKTELKEQLTEHLCTIIQQNEARKAKKLEELMQQLEVEADEE 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GorabNP_788523.1 Transcrip_act <200..316 CDD:309879 53/115 (46%)
gorabXP_002933832.1 Transcrip_act 124..269 CDD:282763 63/155 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 124 1.000 Domainoid score I5491
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1277705at2759
OrthoFinder 1 1.000 - - FOG0007411
OrthoInspector 1 1.000 - - oto102700
Panther 1 1.100 - - LDO PTHR21470
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5537
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.020

Return to query results.
Submit another query.