Sequence 1: | NP_001245715.1 | Gene: | Pp2B-14D / 32624 | FlyBaseID: | FBgn0011826 | Length: | 570 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_014182.1 | Gene: | PPN2 / 855504 | SGDID: | S000005161 | Length: | 326 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 270 | Identity: | 53/270 - (19%) |
---|---|---|---|
Similarity: | 99/270 - (36%) | Gaps: | 75/270 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 138 LRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFE--VGGSPASTKYLFLGDYVDRGYFSIECVLYLW 200
Fly 201 SLKITYPQTLFLLRGNHECRHLTEY-----------------FTFKQEC---------------- 232
Fly 233 ---KIKYSE--RVYDACMDAFDCLPLAALMNQQFLCVHGGL----------SPEIHELEDIRRLD 282
Fly 283 --------RFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSY----AACCDFL 335
Fly 336 QNNNLLSIIR 345 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Pp2B-14D | NP_001245715.1 | MPP_PP2B | 107..411 | CDD:277361 | 53/270 (20%) |
PPN2 | NP_014182.1 | MPP_PPP_family | 64..307 | CDD:277316 | 51/256 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0639 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |