DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and PPH3

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_010360.1 Gene:PPH3 / 851647 SGDID:S000002482 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:275 Identity:112/275 - (40%)
Similarity:158/275 - (57%) Gaps:17/275 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 IEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYV 186
            |.|....::..:...||..|..:..::.|||:|||||||.:||:.|||..|....|:|:||||:|
Yeast    17 IPEETVFRLCLNSQELLMNEGNVTQVDTPVTICGDIHGQLHDLLTLFEKSGGVEKTRYIFLGDFV 81

  Fly   187 DRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDC 250
            |||::|:|..|.|...|:.||..:.|:|||||.|.:|:.:.|..|...|| :..|:..|.:.||.
Yeast    82 DRGFYSLESFLLLLCYKLRYPDRITLIRGNHETRQITKVYGFYDEVVRKYGNSNVWRYCCEVFDY 146

  Fly   251 LPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYT 315
            |.|.|::|....||||||||::..:::||.:||.:|.|..|.|||||||||         .|..|
Yeast   147 LSLGAIINNSIFCVHGGLSPDMTTVDEIRTIDRKQEVPHEGAMCDLLWSDP---------EDVDT 202

  Fly   316 HN-SVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD 379
            .: |.||..:.:.......||:.||:..|.|||:....||    |....|  .|:|::|||||..
Yeast   203 WSLSPRGAGFLFGKREVDQFLEKNNVELIARAHQLVMEGY----KEMFDG--GLVTVWSAPNYCY 261

  Fly   380 VYNNKAAVLKYENNV 394
            ...|.|||||.::::
Yeast   262 RCGNVAAVLKIDDDL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 112/275 (41%)
PPH3NP_010360.1 MPP_PP2A_PP4_PP6 3..286 CDD:277360 112/275 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.