DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and SIT4

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_010236.1 Gene:SIT4 / 851513 SGDID:S000002205 Length:311 Species:Saccharomyces cerevisiae


Alignment Length:276 Identity:115/276 - (41%)
Similarity:159/276 - (57%) Gaps:20/276 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFE-VGGSPASTKYLFLGDYVDRGYFSIECVLYLW 200
            ||.:|..:..::.||||||||||||:||::||. .||.|....|:||||||||||:|:|....|.
Yeast    34 LLMEESNIQPVQTPVTVCGDIHGQFHDLLELFRTAGGFPDDINYIFLGDYVDRGYYSLETFTLLM 98

  Fly   201 SLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCV 264
            .||:.||..:.|:|||||.|.:|:.:.|.:||..|| |..|:..|...||.|.|||:::.:.|||
Yeast    99 CLKVKYPAKITLVRGNHESRQITQVYGFYEECLNKYGSTTVWKYCCQVFDFLTLAAIIDGKILCV 163

  Fly   265 HGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYA 329
            ||||||||..|:.||.|.|.:|.|..|...|||||||       .|.:.: ..|.||..:.:...
Yeast   164 HGGLSPEIRMLDQIRVLSRAQEVPHEGGFSDLLWSDP-------DNVEAW-QVSPRGAGWLFGSK 220

  Fly   330 ACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFP--SLITIFSAPNYLDVYNNKAAVLKYEN 392
            ...:|...|.|..|.|||:....|::.:       ||  .::|::|||||.....|.|:|:|.:.
Yeast   221 VAREFNHVNGLNLIARAHQLVMEGFKYH-------FPEKDVVTVWSAPNYCYRCGNVASVMKVDE 278

  Fly   393 NV-MNIRQFNCSPHPY 407
            :: ...:.|:..|..|
Yeast   279 DLEPTFKIFSAVPDDY 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 115/276 (42%)
SIT4NP_010236.1 MPP_PP2A_PP4_PP6 7..291 CDD:277360 113/271 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.