DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and Ppp4c

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001347393.1 Gene:Ppp4c / 56420 MGIID:1891763 Length:307 Species:Mus musculus


Alignment Length:309 Identity:118/309 - (38%)
Similarity:173/309 - (55%) Gaps:40/309 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 LAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAA---------LLRQEKTMIDIEAPV 151
            :||:.|                |:.:||:....::|::...         :|.:|..:..:::||
Mouse     1 MAEISD----------------LDRQIEQLRRCELIKESEVKALCAKAREILVEESNVQRVDSPV 49

  Fly   152 TVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGN 216
            |||||||||||||.:||.|||....|.|||:||:||||::|:|..|.|.:||:.||..:.|:|||
Mouse    50 TVCGDIHGQFYDLKELFRVGGDVPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGN 114

  Fly   217 HECRHLTEYFTFKQECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRR 280
            ||.|.:|:.:.|..||..|| |..|:..|.:.||.|.|:|:::.:..||||||||.|..|:.||.
Mouse   115 HESRQITQVYGFYDECLRKYGSVTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRT 179

  Fly   281 LDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIR 345
            :||.:|.|..|||||||||||.:..|        ...|.||..|.:.......|...|::..|.|
Mouse   180 IDRKQEVPHDGPMCDLLWSDPEDTTG--------WGVSPRGAGYLFGSDVVAQFNAANDIDMICR 236

  Fly   346 AHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNV 394
            ||:....||:.:...      :::|::|||||.....|.||:|:.:.::
Mouse   237 AHQLVMEGYKWHFNE------TVLTVWSAPNYCYRCGNVAAILELDEHL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 115/298 (39%)
Ppp4cNP_001347393.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 116/304 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.