DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and ppp4cb

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001104638.1 Gene:ppp4cb / 562705 ZFINID:ZDB-GENE-080219-32 Length:307 Species:Danio rerio


Alignment Length:287 Identity:114/287 - (39%)
Similarity:168/287 - (58%) Gaps:24/287 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 LEGRIEEAPALKIIQDGAA---------LLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGS 173
            |:.:|::....::|::...         :|.:|..:..:::|||||||||||||||.:||.|||.
Zfish     7 LDRQIDQLRRCELIKENEVKALCAKAREILVEESNVQRVDSPVTVCGDIHGQFYDLKELFRVGGD 71

  Fly   174 PASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-S 237
            ...|.|||:||:||||::|:|..|.|.:||:.||..:.|:|||||.|.:|:.:.|..||..|| |
Zfish    72 VPETNYLFMGDFVDRGFYSVETFLLLLALKVRYPDRITLIRGNHESRQITQVYGFYDECLRKYGS 136

  Fly   238 ERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPL 302
            ..|:..|.:.||.|.|:|:::.:..||||||||.|..|:.||.:||.:|.|..|||||||||||.
Zfish   137 VTVWRYCTEIFDYLSLSAIIDGKIFCVHGGLSPSIQTLDQIRTIDRKQEVPHDGPMCDLLWSDPE 201

  Fly   303 EDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPS 367
            :..|        ...|.||..|.:.......|...|::..|.|||:....||:.:...      :
Zfish   202 DTTG--------WGVSPRGAGYLFGSDVVAQFNAANDIDMICRAHQLVMEGYKWHFNE------T 252

  Fly   368 LITIFSAPNYLDVYNNKAAVLKYENNV 394
            ::|::|||||.....|.||:|:.:.::
Zfish   253 VLTVWSAPNYCYRCGNVAAILELDEHL 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 114/287 (40%)
ppp4cbNP_001104638.1 MPP_PP2A_PP4_PP6 6..290 CDD:277360 114/287 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.