DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and PPP1CC

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:XP_011536806.1 Gene:PPP1CC / 5501 HGNCID:9283 Length:362 Species:Homo sapiens


Alignment Length:321 Identity:116/321 - (36%)
Similarity:177/321 - (55%) Gaps:37/321 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VDSVPFPPSHKLTLAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQEKTMIDI 147
            :||:         :..:.:.|..||...:..|...:.|         :......:...:..::::
Human     9 IDSI---------IQRLLEVRGSKPGKNVQLQENEIRG---------LCLKSREIFLSQPILLEL 55

  Fly   148 EAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFL 212
            |||:.:|||||||:|||::|||.||.|..:.|||||||||||..|:|.:..|.:.||.||:..||
Human    56 EAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL 120

  Fly   213 LRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELED 277
            |||||||..:...:.|..|||.:|:.:::....|.|:|||:||:::::..|.||||||::..:|.
Human   121 LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQ 185

  Fly   278 IRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLS 342
            |||:.|..:.|..|.:||||||||.:|......:|       ||.|:.:.......||..::|..
Human   186 IRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGEND-------RGVSFTFGAEVVAKFLHKHDLDL 243

  Fly   343 IIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 403
            |.|||:..:.||..:.|.|      |:|:||||||...::|..|::..:..:|      ||
Human   244 ICRAHQVVEDGYEFFAKRQ------LVTLFSAPNYCGEFDNAGAMMSVDETLM------CS 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 112/297 (38%)
PPP1CCXP_011536806.1 PTZ00480 6..315 CDD:185658 116/321 (36%)
MPP_PP1_PPKL 8..298 CDD:277359 116/321 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.