DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and mts

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001285724.1 Gene:mts / 45959 FlyBaseID:FBgn0004177 Length:309 Species:Drosophila melanogaster


Alignment Length:307 Identity:123/307 - (40%)
Similarity:177/307 - (57%) Gaps:19/307 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DQRTGKPNHELLKQHFILE-GRIEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDL 164
            |:.|.|...:.::|  :.| .::.|.....:......:|.:|..:.:::.|||||||:||||:||
  Fly     3 DKATTKDLDQWIEQ--LNECNQLTETQVRTLCDKAKEILSKESNVQEVKCPVTVCGDVHGQFHDL 65

  Fly   165 MKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFK 229
            |:||.:||....|.|||:||||||||:|:|.|..|.:||:.|.:.:.:||||||.|.:|:.:.|.
  Fly    66 MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFY 130

  Fly   230 QECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPM 293
            .||..|| :..|:....|.||.|||.||::.|..|:||||||.|..|:.||.|||.:|.|..|||
  Fly   131 DECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDSLDHIRALDRLQEVPHEGPM 195

  Fly   294 CDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYR 358
            |||||||| :|.|.       ...|.||..|.:.......|...|.|..:.|||:....||....
  Fly   196 CDLLWSDP-DDRGG-------WGISPRGAGYTFGQDISETFNNTNGLTLVSRAHQLVMEGYNWCH 252

  Fly   359 KSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNV-MNIRQFNCSP 404
            ..      :::||||||||.....|:||:::.:::: .:..||:.:|
  Fly   253 DR------NVVTIFSAPNYCYRCGNQAALMELDDSLKFSFLQFDPAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 120/301 (40%)
mtsNP_001285724.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 119/299 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438814
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.