DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and flw

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_727418.1 Gene:flw / 44289 FlyBaseID:FBgn0000711 Length:461 Species:Drosophila melanogaster


Alignment Length:420 Identity:140/420 - (33%)
Similarity:216/420 - (51%) Gaps:49/420 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QSSSVAQAATSARTVSAGSAEATDANSTASNNNNNSSSTAAA-----GNNSDNSSPTTGTGTGAS 65
            |...:||     :..:||.|....|.|..|::|.:|.:..|:     |:.|...:|..|.|.|:|
  Fly    30 QKLLIAQ-----QLAAAGGASGASATSPTSSSNYSSMAAVASFGSGYGSGSGAGAPGAGAGPGSS 89

  Fly    66 TGKLHGGHTAVNTKERVVDSVPFPPSHKLTLAEVFDQRT-------GKPNHELLKQHFILE---- 119
            ...|   ......:.|::......|..:..::...||.|       .|.:...|:..|:.|    
  Fly    90 HDPL---DDLTEQQRRLLQQYSISPPSETMISADGDQITVHHPREEPKKSRLKLRDFFVAEFVRS 151

  Fly   120 ---GR---IEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTK 178
               |:   :.||....:......:..|:..::::|||:.:|||||||:.||::|||.||.|.:..
  Fly   152 CRTGKQVQMTEAEVRGLCLKSREIFLQQPILLELEAPLIICGDIHGQYTDLLRLFEYGGFPPAAN 216

  Fly   179 YLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDA 243
            |||||||||||..|:|.:..|.:.||.||:..|||||||||..:...:.|..|||.:|:.:::..
  Fly   217 YLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNVKLWKT 281

  Fly   244 CMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNE 308
            ..|.|:|||:||:::::..|.||||||::..:|.||||.|..:.|..|.:||||||||.:|....
  Fly   282 FTDCFNCLPVAAIIDEKIFCCHGGLSPDLQGMEQIRRLMRPTDVPDTGLLCDLLWSDPDKDVQGW 346

  Fly   309 KNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFS 373
            ..:|       ||.|:.:.......||..:.|..|.|||:..:.||..:.:.|      |:|:||
  Fly   347 GEND-------RGVSFTFGVDVVSKFLNRHELDLICRAHQVVEDGYEFFARRQ------LVTLFS 398

  Fly   374 APNYLDVYNNKAAVLKYENNVMNIRQFNCS 403
            ||||...::|...::..::.:|      ||
  Fly   399 APNYCGEFDNAGGMMTVDDTLM------CS 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 114/307 (37%)
flwNP_727418.1 MPP_PP1_PPKL 149..428 CDD:277359 111/293 (38%)
PP2Ac 160..430 CDD:197547 110/282 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438877
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.