DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and rdgC

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_536738.3 Gene:rdgC / 40224 FlyBaseID:FBgn0265959 Length:746 Species:Drosophila melanogaster


Alignment Length:353 Identity:103/353 - (29%)
Similarity:165/353 - (46%) Gaps:63/353 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 VNTKERVVDSVPFPPSHKLTLAEVFDQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQ 140
            ||.|    ..:|...:|...|.:||.::.|              .|:.......|:::.|..|:|
  Fly   177 VNAK----IELPIRKNHIDLLIDVFRKKRG--------------NRLHPKYVALILREAAKSLKQ 223

  Fly   141 ----EKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTK-YLFLGDYVDRGYFSIECVLYLW 200
                ......:...||||||:||:..||:.:....|.|:|:. |:|.||:||||...:|.:|.|.
  Fly   224 LPNISPVSTAVSQQVTVCGDLHGKLDDLLVVLHKNGLPSSSNPYVFNGDFVDRGKRGLEVLLLLL 288

  Fly   201 SLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY---SERVYDACMDAFDCLPLAALMNQQFL 262
            ||.:.:|..:||.|||||...:...:.|.:|.:.||   .:|:.....:.:..|||.:::|.:.|
  Fly   289 SLYLAFPNAVFLNRGNHEDSVMNARYGFIREVESKYPRNHKRILAFIDEVYRWLPLGSVLNSRVL 353

  Fly   263 CVHGGLSPEIHELEDIRRLDRFK-----EPP----------AFGPMCDLLWSDPLEDFGNEKNSD 312
            .||||.| :...|:.|:.:||.|     .||          .:..:.|::||||....|      
  Fly   354 IVHGGFS-DSTSLDLIKSIDRGKYVSILRPPLTDGEPLDKTEWQQIFDIMWSDPQATMG------ 411

  Fly   313 FYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNY 377
             ...|::||...::......:|||.:.|..:||:||.:..|:.....::      :||||||.||
  Fly   412 -CVPNTLRGAGVWFGPDVTDNFLQRHRLSYVIRSHECKPNGHEFMHDNK------IITIFSASNY 469

  Fly   378 LDVYNNKAAVLKYENNVMNIRQFNCSPH 405
            ..:.:||.|.::..|.:|        ||
  Fly   470 YAIGSNKGAYIRLNNQLM--------PH 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 94/322 (29%)
rdgCNP_536738.3 IQ 89..111 CDD:197470
MPP_RdgC 184..494 CDD:277364 100/342 (29%)
EFh 616..681 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438801
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.