DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and Y71G12B.30

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001021823.2 Gene:Y71G12B.30 / 3565302 WormBaseID:WBGene00044347 Length:333 Species:Caenorhabditis elegans


Alignment Length:319 Identity:110/319 - (34%)
Similarity:165/319 - (51%) Gaps:36/319 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PFPPSHKLTLAEVF--DQRTGKPNHELLKQHFILEGRIEEAPALKIIQDGAALLRQEKTMIDIEA 149
            |..|.|:.....:|  .|.....|.:.|         .:|...::|.........:|...::|||
 Worm     8 PGSPLHRKLTNVIFRLTQSWSPGNCQTL---------FQEKEIIEICYRAREAFWKEPMKLEIEA 63

  Fly   150 PVTVCGDIHGQFYDLMKLFEVGGSP------ASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQ 208
            |||:||||||||.||:.:|::.|.|      .|::|||||||:|||.||||.:..|::.::.:||
 Worm    64 PVTICGDIHGQFEDLLSMFDIYGFPHVSQKDKSSRYLFLGDYIDRGPFSIEVITLLFAYRLLHPQ 128

  Fly   209 TLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIH 273
            .:||||||||.|.:...:.|..|||.:||..:|:....||.|:||.|::..:.:|:|||:...:.
 Worm   129 KMFLLRGNHESRPVNMQYGFYNECKRRYSVTLYETFQWAFYCMPLCAIVGGRIMCMHGGIPFGLL 193

  Fly   274 ELEDIRRLDRFKEPPAF---GPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFL 335
            .||.|   |.|:.|...   |...||.|:||:......::|.       ||..:.:..|...:|.
 Worm   194 SLEQI---DEFQRPTDIADVGIPSDLCWADPVSGVVGFQDSP-------RGAGHVFGEATVKEFN 248

  Fly   336 QNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNV 394
            :...|..|:|||:....||..:...:      |:||||||.|...::|..|||:...|:
 Worm   249 EKFKLDLIVRAHQVVMDGYEFFADKK------LVTIFSAPCYCGHFDNLGAVLQVATNM 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 105/297 (35%)
Y71G12B.30NP_001021823.2 PP2Ac 36..308 CDD:197547 103/282 (37%)
MPP_superfamily 36..304 CDD:301300 103/282 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.