DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and Pp1-Y2

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_001015497.4 Gene:Pp1-Y2 / 3355173 FlyBaseID:FBgn0046698 Length:313 Species:Drosophila melanogaster


Alignment Length:260 Identity:102/260 - (39%)
Similarity:152/260 - (58%) Gaps:19/260 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 MIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQ 208
            ::::.|||.:||||||||.||::||:.||.|.::.|||||||||||..|||.:..|.:.||.||:
  Fly    54 LLELSAPVKICGDIHGQFTDLLRLFDYGGYPPASNYLFLGDYVDRGKQSIETMCLLLAYKIKYPE 118

  Fly   209 TLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIH 273
            ..||||||||...:...:.|..|||.:|:.:::...:|.:.|:|::|:::::..|.||||||::.
  Fly   119 NFFLLRGNHESAGINRIYGFYDECKRRYTIKLWRTFVDCYSCMPVSAIVDEKIFCCHGGLSPDLL 183

  Fly   274 ELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNN 338
            .:..|.:|.|..:.|..|.:||||||||........::|       ||.|..:.......|:..:
  Fly   184 NMNQIGQLARPCDVPDKGLLCDLLWSDPDPKIMGWSDND-------RGVSVTFGADIVGKFVHRH 241

  Fly   339 NLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVMNIRQFNCS 403
            ....|.|||:..:.||..:.|.|      ||||||||||...::|..|::..:..:|      ||
  Fly   242 KFDLICRAHQVVEDGYEFFAKRQ------LITIFSAPNYCGEFDNAGAMMSVDETLM------CS 294

  Fly   404  403
              Fly   295  294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 102/260 (39%)
Pp1-Y2NP_001015497.4 PTZ00480 10..303 CDD:185658 102/260 (39%)
MPP_PP1_PPKL 13..300 CDD:277359 102/260 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.