DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and Ppp2ca

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_058735.1 Gene:Ppp2ca / 24672 RGDID:3380 Length:309 Species:Rattus norvegicus


Alignment Length:286 Identity:118/286 - (41%)
Similarity:167/286 - (58%) Gaps:16/286 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 RIEEAPALKIIQDGAALLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDY 185
            ::.|:....:.:....:|.:|..:.::..|||||||:||||:|||:||.:||....|.|||:|||
  Rat    22 QLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDY 86

  Fly   186 VDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFD 249
            |||||:|:|.|..|.:||:.|.:.:.:||||||.|.:|:.:.|..||..|| :..|:....|.||
  Rat    87 VDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD 151

  Fly   250 CLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFY 314
            .|||.||::.|..|:||||||.|..|:.||.|||.:|.|..||||||||||| :|.|.       
  Rat   152 YLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDP-DDRGG------- 208

  Fly   315 THNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLD 379
            ...|.||..|.:.......|...|.|..:.|||:....||......      :::||||||||..
  Rat   209 WGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDR------NVVTIFSAPNYCY 267

  Fly   380 VYNNKAAVLKYENNV-MNIRQFNCSP 404
            ...|:||:::.::.: .:..||:.:|
  Rat   268 RCGNQAAIMELDDTLKYSFLQFDPAP 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 118/286 (41%)
Ppp2caNP_058735.1 MPP_PP2A_PP4_PP6 9..293 CDD:277360 117/284 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.