DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and Ppp1cb

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_766295.2 Gene:Ppp1cb / 19046 MGIID:104871 Length:327 Species:Mus musculus


Alignment Length:286 Identity:111/286 - (38%)
Similarity:165/286 - (57%) Gaps:30/286 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KIIQDGAALLR-----------QEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFL 182
            ||:|...|.:|           .:..::::|||:.:|||||||:.||::|||.||.|....||||
Mouse    25 KIVQMTEAEVRGLCIKSREIFLSQPILLELEAPLKICGDIHGQYTDLLRLFEYGGFPPEANYLFL 89

  Fly   183 GDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKYSERVYDACMDA 247
            |||||||..|:|.:..|.:.||.||:..|||||||||..:...:.|..|||.:::.:::....|.
Mouse    90 GDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTDC 154

  Fly   248 FDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSD 312
            |:|||:||:::::..|.||||||::..:|.|||:.|..:.|..|.:||||||||.:|......:|
Mouse   155 FNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWGEND 219

  Fly   313 FYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNY 377
                   ||.|:.:.......||..::|..|.|||:..:.||..:.|.|      |:|:||||||
Mouse   220 -------RGVSFTFGADVVSKFLNRHDLDLICRAHQVVEDGYEFFAKRQ------LVTLFSAPNY 271

  Fly   378 LDVYNNKAAVLKYENNVMNIRQFNCS 403
            ...::|...::..:..:|      ||
Mouse   272 CGEFDNAGGMMSVDETLM------CS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 111/286 (39%)
Ppp1cbNP_766295.2 MPP_PP1_PPKL 7..297 CDD:277359 111/286 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..327
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.