DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and ZC477.2

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_501111.2 Gene:ZC477.2 / 177485 WormBaseID:WBGene00022617 Length:374 Species:Caenorhabditis elegans


Alignment Length:316 Identity:102/316 - (32%)
Similarity:158/316 - (50%) Gaps:67/316 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KIIQDGAALLR----------------------QEKTMIDIEAPVTVCGDIHGQFYDLMK----- 166
            |:||.|..:.|                      :|:.::::.|||||.||:||.|:||.:     
 Worm    37 KMIQPGRVMKRSKNNLSSNEVWSVCRAVIDEFKKEQNLMEVSAPVTVIGDVHGNFHDLYRALLAR 101

  Fly   167 ----LFEVGGSPAST------KYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRH 221
                :.:...|..||      ||:|||:|:|:|..||||:..|::.||.:||...||||.|||..
 Worm   102 TEQDITDEQKSNFSTRQFVRDKYVFLGNYIDKGPRSIECICLLFAFKICFPQKYILLRGPHECPS 166

  Fly   222 L--TEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRF 284
            :  :|:....:.....:.::::....:||..:||||::.|:.||||||:||.:...||||::.|.
 Worm   167 VNSSEFLGVMETFSPNHFKKIHKKFNEAFSWMPLAAVVGQKILCVHGGISPRLTSWEDIRKIKRP 231

  Fly   285 KEPPAFGPMC-DLLWSDPLEDFGNEKNSDF-----------YTHNSVRGCSYFYSYAACCDFLQN 337
            .:.....|:. |||::|.|         ||           |..|.:|..|..|:.||...|.:.
 Worm   232 LKDATEDPLATDLLFADTL---------DFDLIHIPTRKPKYEFNVIRNMSVMYNEAAVTQFCEK 287

  Fly   338 NNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYENN 393
            .||..|||:|.....|||.:.:.:      |||||::..:.: .:|..||||.:.|
 Worm   288 FNLKLIIRSHMKVPFGYRFFSEKR------LITIFNSTGFQN-ESNYGAVLKIDGN 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 102/316 (32%)
ZC477.2NP_501111.2 PP2Ac 52..348 CDD:197547 97/301 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.