DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pp2B-14D and Ppp6c

DIOPT Version :9

Sequence 1:NP_001245715.1 Gene:Pp2B-14D / 32624 FlyBaseID:FBgn0011826 Length:570 Species:Drosophila melanogaster
Sequence 2:NP_598273.2 Gene:Ppp6c / 171121 RGDID:708460 Length:305 Species:Rattus norvegicus


Alignment Length:287 Identity:117/287 - (40%)
Similarity:165/287 - (57%) Gaps:29/287 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 LLRQEKTMIDIEAPVTVCGDIHGQFYDLMKLFEVGGSPASTKYLFLGDYVDRGYFSIECVLYLWS 201
            ||.:|..:..:..|||||||||||||||.:||..||....|.|:|:||:|||||:|:|...||.:
  Rat    34 LLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMGDFVDRGYYSLETFTYLLA 98

  Fly   202 LKITYPQTLFLLRGNHECRHLTEYFTFKQECKIKY-SERVYDACMDAFDCLPLAALMNQQFLCVH 265
            ||..:|..:.|||||||.|.:|:.:.|..||:.|| :...:..|...||.|.:|||:::|.||||
  Rat    99 LKAKWPDRITLLRGNHESRQITQVYGFYDECQTKYGNANAWRYCTKVFDMLTVAALIDEQILCVH 163

  Fly   266 GGLSPEIHELEDIRRLDRFKEPPAFGPMCDLLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAA 330
            |||||:|..|:.||.::|.:|.|..|..|||:|||| ||.      |.:. .|.||..:.:....
  Rat   164 GGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDP-EDV------DTWA-ISPRGAGWLFGAKV 220

  Fly   331 CCDFLQNNNLLSIIRAHEAQDAGYR-MYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVLKYEN-N 393
            ..:|:..|||..|.|||:....||: |:.:       .|:|::|||||.....|.|:::.::: |
  Rat   221 TNEFVHINNLKLICRAHQLVHEGYKFMFDE-------KLVTVWSAPNYCYRCGNIASIMVFKDVN 278

  Fly   394 VMNIRQFNCSPH-----------PYWL 409
            ....:.|...|.           ||:|
  Rat   279 TREPKLFRAVPDSERVIPPRTTTPYFL 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pp2B-14DNP_001245715.1 MPP_PP2B 107..411 CDD:277361 117/287 (41%)
Ppp6cNP_598273.2 MPP_PP2A_PP4_PP6 5..289 CDD:277360 113/269 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.