DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and NIT2

DIOPT Version :10

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_012409.1 Gene:NIT2 / 853316 SGDID:S000003662 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:32/174 - (18%)
Similarity:59/174 - (33%) Gaps:35/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LQANLAGYLEIMASG-NGTTDIIVFPEAT-------LNSVITLTAVPKFTEQSLCEEQGDDDPEI 105
            |..||....|:::.. ....|::..|||:       |:|.......|||..|             
Yeast    19 LTKNLKVVKELISEAIQKKADVVFLPEASDYLSQNPLHSRYLAQKSPKFIRQ------------- 70

  Fly   106 APFLRSLACAAREYGTYLVVNVKERVSEQCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNL 170
              ...|:....|:....:.|::...:.   .|::........:.|..:..|.:|.::..|:|.:|
Yeast    71 --LQSSITDLVRDNSRNIDVSIGVHLP---PSEQDLLEGNDRVRNVLLYIDHEGKILQEYQKLHL 130

  Fly   171 Y---------LEPSTNRTESPEIATFTTDFNVTFGHFICFDMLF 205
            :         |:.|.:......|...........|..||:|:.|
Yeast   131 FDVDVPNGPILKESKSVQPGKAIPDIIESPLGKLGSAICYDIRF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 32/174 (18%)
Vanin_C 320..495 CDD:465946
NIT2NP_012409.1 nit 7..302 CDD:143596 32/174 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.