DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and NIT2

DIOPT Version :9

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_012409.1 Gene:NIT2 / 853316 SGDID:S000003662 Length:307 Species:Saccharomyces cerevisiae


Alignment Length:174 Identity:32/174 - (18%)
Similarity:59/174 - (33%) Gaps:35/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LQANLAGYLEIMASG-NGTTDIIVFPEAT-------LNSVITLTAVPKFTEQSLCEEQGDDDPEI 105
            |..||....|:::.. ....|::..|||:       |:|.......|||..|             
Yeast    19 LTKNLKVVKELISEAIQKKADVVFLPEASDYLSQNPLHSRYLAQKSPKFIRQ------------- 70

  Fly   106 APFLRSLACAAREYGTYLVVNVKERVSEQCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNL 170
              ...|:....|:....:.|::...:.   .|::........:.|..:..|.:|.::..|:|.:|
Yeast    71 --LQSSITDLVRDNSRNIDVSIGVHLP---PSEQDLLEGNDRVRNVLLYIDHEGKILQEYQKLHL 130

  Fly   171 Y---------LEPSTNRTESPEIATFTTDFNVTFGHFICFDMLF 205
            :         |:.|.:......|...........|..||:|:.|
Yeast   131 FDVDVPNGPILKESKSVQPGKAIPDIIESPLGKLGSAICYDIRF 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 32/174 (18%)
NIT2NP_012409.1 nit 7..302 CDD:143596 32/174 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.