DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and NIT2

DIOPT Version :9

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_064587.1 Gene:NIT2 / 56954 HGNCID:29878 Length:276 Species:Homo sapiens


Alignment Length:227 Identity:51/227 - (22%)
Similarity:86/227 - (37%) Gaps:65/227 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIVFPEATLNSVITLTAVPKFTEQSLCEEQGDDDPEIAPFLRSLACAAREYGTYLVVNVKERVSE 133
            |:..||. .||.......|::.|:...|.           .:.|:..|:|...||:..   .:.|
Human    38 IVSLPEC-FNSPYGAKYFPEYAEKIPGES-----------TQKLSEVAKECSIYLIGG---SIPE 87

  Fly   134 QCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNLY-------LEPSTNRTESP--EIATFTT 189
            :...         .::||..||...|.::::|||.:|:       :....::|.||  ..:||.|
Human    88 EDAG---------KLYNTCAVFGPDGTLLAKYRKIHLFDIDVPGKITFQESKTLSPGDSFSTFDT 143

  Fly   190 DF-NVTFGHFICFDMLFYTPAQDLVEQLGIRHVIVTKMFN------------------SELPFLT 235
            .: .|..|  ||:||.|...|| :..|.|.:.::....||                  :::...|
Human   144 PYCRVGLG--ICYDMRFAELAQ-IYAQRGCQLLVYPGAFNLTTGPAHWELLQRSRAVDNQVYVAT 205

  Fly   236 ASQFQQ------GWAWANRVN----LLASGGS 257
            ||..:.      .|..:..||    :||..|:
Human   206 ASPARDDKASYVAWGHSTVVNPWGEVLAKAGT 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 51/227 (22%)
NIT2NP_064587.1 nit 5..265 CDD:143596 51/227 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.