Sequence 1: | NP_727067.1 | Gene: | CG32750 / 326238 | FlyBaseID: | FBgn0052750 | Length: | 523 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_064587.1 | Gene: | NIT2 / 56954 | HGNCID: | 29878 | Length: | 276 | Species: | Homo sapiens |
Alignment Length: | 227 | Identity: | 51/227 - (22%) |
---|---|---|---|
Similarity: | 86/227 - (37%) | Gaps: | 65/227 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 IIVFPEATLNSVITLTAVPKFTEQSLCEEQGDDDPEIAPFLRSLACAAREYGTYLVVNVKERVSE 133
Fly 134 QCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNLY-------LEPSTNRTESP--EIATFTT 189
Fly 190 DF-NVTFGHFICFDMLFYTPAQDLVEQLGIRHVIVTKMFN------------------SELPFLT 235
Fly 236 ASQFQQ------GWAWANRVN----LLASGGS 257 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32750 | NP_727067.1 | biotinidase_like | 29..322 | CDD:143591 | 51/227 (22%) |
NIT2 | NP_064587.1 | nit | 5..265 | CDD:143596 | 51/227 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0388 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |