DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and nit2

DIOPT Version :9

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001016633.2 Gene:nit2 / 549387 XenbaseID:XB-GENE-946902 Length:282 Species:Xenopus tropicalis


Alignment Length:170 Identity:40/170 - (23%)
Similarity:68/170 - (40%) Gaps:37/170 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 IIVFPEATLNSVITLTAVPKFTEQSLCEEQGDDDPEIAPFLRSLACAAREYGTYLV-VNVKERVS 132
            |:..||. .||.......|::.|:...|.           ...|:..|:|.|.||: .::.|..|
 Frog    44 IVALPEC-FNSPYGTKYFPEYAEKIPGES-----------TERLSQVAKECGIYLIGGSIPEEDS 96

  Fly   133 EQCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNLY-------LEPSTNRTESP--EIATFT 188
            .:             ::||..||...|.::.::||.:|:       :....:.|.||  ..:.|.
 Frog    97 GK-------------LYNTCAVFGPDGTLLVKHRKIHLFDIDVPGKIRFQESETLSPGDSFSVFE 148

  Fly   189 TDFNVTFGHFICFDMLFYTPAQDLVEQLGIRHVIVTKMFN 228
            |.: ...|..||:|:.|...|| |..:.|.:.::....||
 Frog   149 TPY-CKVGVGICYDIRFAELAQ-LYSKKGCQLLVYPGAFN 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 40/170 (24%)
nit2NP_001016633.2 nit 11..271 CDD:143596 40/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.