DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and nit1

DIOPT Version :10

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_001004638.2 Gene:nit1 / 447900 ZFINID:ZDB-GENE-040912-65 Length:316 Species:Danio rerio


Alignment Length:69 Identity:17/69 - (24%)
Similarity:35/69 - (50%) Gaps:12/69 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 IHNTNVVFDRQGAVISRYRKWNLYLEPSTNRTESPEIATFT-----------TDFNVTFGHFICF 201
            |:|::::.:.||.::|.|||.:|:....:::..|.:.:.||           |... ..|..:|:
Zfish   129 IYNSHIIINGQGEIVSVYRKTHLFDVELSSKGVSLKESAFTIPGPRLVPPVQTPIG-KVGLGVCY 192

  Fly   202 DMLF 205
            |:.|
Zfish   193 DLRF 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 17/69 (25%)
Vanin_C 320..495 CDD:465946
nit1NP_001004638.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.