DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and CG8132

DIOPT Version :10

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_649888.1 Gene:CG8132 / 41121 FlyBaseID:FBgn0037687 Length:283 Species:Drosophila melanogaster


Alignment Length:127 Identity:30/127 - (23%)
Similarity:56/127 - (44%) Gaps:20/127 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 RSLACAAREYGTYLVVNVKERVSEQCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNLY-LE 173
            :.|:..||::..|:|......:.|   :|        :|:||..|:...|.:::::||.:|: ::
  Fly    73 QQLSNLARKHQVYIVGGTIPELGE---ND--------AIYNTCTVWSPTGDLVAKHRKMHLFDID 126

  Fly   174 PSTN-RTESPEIATFTTDFNV------TFGHFICFDMLFYTPAQDLVEQLGIRHVIVTKMFN 228
            .... |.:..|..:...||.:      ..|..||:|:.|...|: |....|...:|....||
  Fly   127 VKGGIRFKESETLSAGNDFTIINVDGHKIGIGICYDIRFEEMAR-LYRNAGCEMIIYPAAFN 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 30/127 (24%)
Vanin_C 320..495 CDD:465946
CG8132NP_649888.1 nit 9..272 CDD:143596 30/127 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.