DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and nit2

DIOPT Version :9

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_991174.3 Gene:nit2 / 402904 ZFINID:ZDB-GENE-050522-65 Length:284 Species:Danio rerio


Alignment Length:193 Identity:45/193 - (23%)
Similarity:68/193 - (35%) Gaps:68/193 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   209 AQDLVEQL---GIRHVIVTKMFNSELPFLTASQFQQGWA-------------WANRVNLLASGGS 257
            ||.||.:.   |.:.|::.:.|||  |:.|.  |.:.:|             .|.:..:...|||
Zfish    31 AQTLVTEAAGQGAKVVVLPECFNS--PYGTG--FFKEYAEKIPGESTQVLSETAKKCGIYLVGGS 91

  Fly   258 LPQGGISGSGIY-----AGQQGALARLMITDELVGQRKLLLAKVPLDPEEPIATDEILEP----- 312
            :|:.  .|..:|     .|..|.|        ||..||:.|..:.:..:......|.|.|     
Zfish    92 IPEE--DGGKLYNTCSVFGPDGKL--------LVTHRKIHLFDIDVPGKIRFQESETLSPGKSLS 146

  Fly   313 -----------------------EIMTPVKLKLLQQPELKNFTT----WELPMVRGSSVDKRI 348
                                   :|......:||..|...|.||    ||| :.||.:||.::
Zfish   147 MFETPYCKVGVGICYDIRFAELAQIYAKKGCQLLVYPGAFNMTTGPAHWEL-LQRGRAVDNQV 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 32/161 (20%)
nit2NP_991174.3 nit 12..272 CDD:143596 45/193 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.