DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and NitFhit

DIOPT Version :9

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_525122.1 Gene:NitFhit / 38029 FlyBaseID:FBgn0024945 Length:460 Species:Drosophila melanogaster


Alignment Length:227 Identity:45/227 - (19%)
Similarity:83/227 - (36%) Gaps:70/227 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 MGGTSEQLLQANLAGYLEIMASGNGTTDIIVF-PEATLNSVITLTAVPKFTEQSLCEEQGDD--- 101
            |..||::  .|||:..:|::.........::| ||.                   |:..|:.   
  Fly    40 MRSTSDK--AANLSQVIELVDRAKSQNACMLFLPEC-------------------CDFVGESRTQ 83

  Fly   102 --------DPEIAPFLRSLACAAREYGTYLVVNVKERVSEQCTSDETCSSRGYSIHNTNVVFDRQ 158
                    |.|:....|.||...:.:  ..:..|.||..::             |.|.:|:.:.:
  Fly    84 TIELSEGLDGELMAQYRELAKCNKIW--ISLGGVHERNDQK-------------IFNAHVLLNEK 133

  Fly   159 GAVISRYRKWNLYLEPSTNRTESPEIATFTTDFNV---------TFGHFICFDMLFYTPAQDLVE 214
            |.:.:.|||.::: :.:|......|..|.|..:.:         ..|..||:|:.|..||     
  Fly   134 GELAAVYRKLHMF-DVTTKEVRLRESDTVTPGYCLERPVSTPVGQIGLQICYDLRFAEPA----- 192

  Fly   215 QLGIRHVIVTKMFNSELPFLTASQFQQGWA-W 245
                  |::.|:..:.|.:.:|..:..|.| |
  Fly   193 ------VLLRKLGANLLTYPSAFTYATGKAHW 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 45/227 (20%)
NitFhitNP_525122.1 nit 34..296 CDD:143596 45/227 (20%)
FHIT 317..436 CDD:238606
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.