DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32750 and upb-1

DIOPT Version :9

Sequence 1:NP_727067.1 Gene:CG32750 / 326238 FlyBaseID:FBgn0052750 Length:523 Species:Drosophila melanogaster
Sequence 2:NP_495261.1 Gene:upb-1 / 174040 WormBaseID:WBGene00017440 Length:387 Species:Caenorhabditis elegans


Alignment Length:238 Identity:53/238 - (22%)
Similarity:79/238 - (33%) Gaps:83/238 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 PFLRSLACAAREYGTYLVVNVKERVSEQCTSDETCSSRGYSIHNTNVVFDRQGAVISRYRKWNLY 171
            |..:.|:..|.::...::..:.||..|:   |:.       |.||.||....|.||.|.||.:: 
 Worm   148 PTTQFLSKLAVKHDIVIISPILERDEEK---DDV-------IWNTAVVISHTGRVIGRSRKNHI- 201

  Fly   172 LEPSTNRTESPEIATF---TTDFNVTFGH------------FICFDMLFYTPAQDLVEQLGIRHV 221
                      |.:..|   |.....|.||            .||:..  :.|...::..|....:
 Worm   202 ----------PRVGDFNESTYYMESTLGHPVFETKYGRIGINICYGR--HHPQNWMMYALNGAEI 254

  Fly   222 IVTKMFNSELPFLTASQFQQG-W-------AWANRV--------------NLLASGGSLPQ---- 260
            |    ||   |..|.....:. |       |.||.|              |...||...|.    
 Worm   255 I----FN---PSATVGALSEPLWGIEARNAAIANHVFTVGINRVGTEVFPNEFTSGNGQPAHKDF 312

  Fly   261 GGISGSGIYAGQQG----ALARLMITDELVGQRKLLLAKVPLD 299
            |...||...|...|    ||:|:        :..:|:|::.|:
 Worm   313 GHFYGSSYIAAPDGSRTPALSRV--------REGVLIAELDLN 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32750NP_727067.1 biotinidase_like 29..322 CDD:143591 53/238 (22%)
upb-1NP_495261.1 ML_beta-AS 11..373 CDD:143611 53/238 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0388
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.