Sequence 1: | NP_727067.1 | Gene: | CG32750 / 326238 | FlyBaseID: | FBgn0052750 | Length: | 523 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_598756.1 | Gene: | Upb1 / 103149 | MGIID: | 2143535 | Length: | 393 | Species: | Mus musculus |
Alignment Length: | 202 | Identity: | 47/202 - (23%) |
---|---|---|---|
Similarity: | 76/202 - (37%) | Gaps: | 56/202 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 GVVEYR---PTFMGGTSEQL--LQANLAGYLEIMASGNGTTDIIVFPEATLN---SVITLTAVPK 88
Fly 89 FTEQSLCEEQGDDDPEIAPFLRSLAC--AAREYGTYLVVNVKERVSEQCTSDETCSSRGYSIHNT 151
Fly 152 NVVFDRQGAVISRYRKWNL-----------YLEPSTNRTESPEIATFTTDF-----NVTFGHFIC 200
Fly 201 FDMLFYT 207 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG32750 | NP_727067.1 | biotinidase_like | 29..322 | CDD:143591 | 47/202 (23%) |
Upb1 | NP_598756.1 | PLN00202 | 6..392 | CDD:177792 | 47/202 (23%) |
ML_beta-AS | 9..371 | CDD:143611 | 47/202 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0388 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |