DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Ubqln4

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_277068.1 Gene:Ubqln4 / 94232 MGIID:2150152 Length:596 Species:Mus musculus


Alignment Length:109 Identity:33/109 - (30%)
Similarity:51/109 - (46%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RGGMQIFVKTLTGKTITLEVEPSD--TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 136
            |..:::.|||...|.   |:...|  :::..|.:|..:.....||..||||||.|:||.|||.:.
Mouse    10 RPQIRVTVKTPKDKE---EIVICDQASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLSQHG 71

  Fly   137 IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA 180
            |:...|:|||::.....|        ..:|....|..|.::..|
Mouse    72 IKDGLTVHLVIKTPQKAQ--------DPVTAAASPPSTPDSASA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 1/1 (100%)
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398 27/76 (36%)
UBQ 77..148 CDD:214563 27/72 (38%)
Ubiquitin 153..228 CDD:176398 5/28 (18%)
UBQ 153..224 CDD:214563 5/28 (18%)
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Ubqln4NP_277068.1 UBQ 13..83 CDD:214563 27/72 (38%)
hPLIC_N 13..83 CDD:176403 27/72 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 89..148 5/27 (19%)
STI1 187..224 CDD:128966
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..361
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 482..528
UBA_PLICs 553..592 CDD:270582
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.