DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and OASL

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_003724.1 Gene:OASL / 8638 HGNCID:8090 Length:514 Species:Homo sapiens


Alignment Length:280 Identity:78/280 - (27%)
Similarity:125/280 - (44%) Gaps:45/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 LEDGRT-----LSDYNI-----QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA 104
            |::|.|     |.:|.:     .|..|||..:     ::..|:....|...:.::|:|...||  
Human   256 LDEGFTTVMDLLLEYEVICIYWTKYYTLHNAI-----IEDCVRKQLKKERPIILDPADPTLNV-- 313

  Fly   105 KIQDKEGIPPD--QQRLIFAGKQ--LEDGR--TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK 163
                .||...|  .||.....||  ..|.|  .:|.:|:::...:||.:..||          ..
Human   314 ----AEGYRWDIVAQRASQCLKQDCCYDNRENPISSWNVKRA
RDIHLTVEQRG----------YP 364

  Fly   164 TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF----AGKQLEDGR-TLSDYNIQKESTLHLVL 223
            ...|.|.|.:.|..||.||:...|. ...|||.|    :.:||...| :|:.|.|...:.::|:.
Human   365 DFNLIVNPYEPIRKVKEKIRRTRGY-SGLQRLSFQVPGSERQLLSSRCSLAKYGIFSHTHIYLLE 428

  Fly   224 RLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN 288
            .:...:|:|||...|.:....:.|:..|..:|.:|:|::|:|..||:|.|.|:.|:|...|..|.
Human   429 TIPSE
IQVFVKNPDGGSYAYAINPNSFILGLKQQIEDQQGLPKKQQQLEFQGQVLQDWLGLGIYG 493

  Fly   289 IQKESTLHLVLRLRGGMQIF 308
            ||...|  |:|..:.|..:|
Human   494 IQDSDT--LILSKKK
GEALF 511

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 9/35 (26%)
UBQ 1..72 CDD:214563 9/31 (29%)
Ubiquitin 77..152 CDD:176398 20/80 (25%)
UBQ 77..148 CDD:214563 19/76 (25%)
Ubiquitin 153..228 CDD:176398 20/79 (25%)
UBQ 153..224 CDD:214563 20/75 (27%)
Ubiquitin 229..304 CDD:176398 26/74 (35%)
UBQ 229..300 CDD:214563 25/70 (36%)
Ubiquitin 305..380 CDD:176398 1/4 (25%)
UBQ 305..376 CDD:214563 1/4 (25%)
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
OASLNP_003724.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390
OAS1_C 168..351 CDD:313619 26/105 (25%)
OASL_repeat1 354..433 CDD:176406 24/89 (27%)
ubiquitin 436..506 CDD:306702 25/71 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.