DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and AT1G53945

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_175798.2 Gene:AT1G53945 / 841834 AraportID:AT1G53945 Length:121 Species:Arabidopsis thaliana


Alignment Length:157 Identity:58/157 - (36%)
Similarity:79/157 - (50%) Gaps:40/157 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   381 MQIFVKTLTGKTITLEV-EPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 444
            |||.:||:.||:|.||| :.||||                                  |..|..|
plant     1 MQISIKTVKGKSINLEVADSSDTI----------------------------------DLKINGE 31

  Fly   445 STLHLVLRLRGG--MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE 507
            .|..|||||...  |:|||.|:..||..|||:.||||:.:|:.|.|:.|.|.|||.|...|.:|:
plant    32 PTRQLVLRLGPAVLMRIFVSTIKEKTFILEVKGSDTIKKLKSMIHDQGGPPVDQQDLNHLGTKLK 96

  Fly   508 DGRTLSDYNIQKESTLHLVLRLRGGAI 534
            :..|:|||||:.::.|.:   ::.|.|
plant    97 NNATISDYNIKPDANLVI---MQNGCI 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398
UBQ 1..72 CDD:214563
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398 24/75 (32%)
UBQ 381..452 CDD:214563 21/71 (30%)
Ubiquitin 457..532 CDD:176398 32/74 (43%)
UBQ 457..528 CDD:214563 32/70 (46%)
AT1G53945NP_175798.2 Ubiquitin_like_fold 46..112 CDD:391949 31/65 (48%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.