DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and AT1G11970

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_172661.1 Gene:AT1G11970 / 837749 AraportID:AT1G11970 Length:99 Species:Arabidopsis thaliana


Alignment Length:134 Identity:29/134 - (21%)
Similarity:51/134 - (38%) Gaps:47/134 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 DTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLT 465
            :.:|||..|::                ::.....||:.:..::       :..|...::..:.|:
plant    10 ELLENVTRKLE----------------RECHHVNTLNSHGKRE-------IAERQRFKVKSQFLS 51

  Fly   466 GKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLR 530
            .|.|.:|::|.|.||.:|..|:::.|||             .|..|...||           |||
plant    52 EKKIDIEIDPMDKIEQIKEGIEEEIGIP-------------SDDLTAEHYN-----------RLR 92

  Fly   531 GGAI 534
            |..|
plant    93 GSVI 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501
Ubl_ubiquitin 77..152 CDD:340501
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501 7/54 (13%)
Ubl_ubiquitin 457..532 CDD:340501 20/74 (27%)
AT1G11970NP_172661.1 Ubl1_cv_Nsp3_N-like 44..97 CDD:475130 22/77 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.