DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and AT5G16090

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_197113.4 Gene:AT5G16090 / 831466 AraportID:AT5G16090 Length:171 Species:Arabidopsis thaliana


Alignment Length:135 Identity:32/135 - (23%)
Similarity:57/135 - (42%) Gaps:23/135 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            |:|.||||.|....:||:|:|::..||..|:...|   .|..||.||...::|.|..|:....:.
plant     1 MKIIVKTLKGIRFEIEVKPNDSVAEVKKNIETVMGASEYPAAQQILIHKREKLRDETTMEANKVF 65

  Fly    63 KESTLHLVL-----------------RLRGGMQIFVKTLTGKTITLE---VEPSDTIENVKAKIQ 107
            .:|.:.:::                 .:|.....||..|..::...:   .:|.:.:..::....
plant    66 DKSVIAIIITKGCLEEMEKQNPPLFQMIRHNSAGFVPVLNKESFERDNELAQPEEDLLQLQVTAV 130

  Fly   108 DKEGI 112
            |.|.|
plant   131 DDEAI 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 25/94 (27%)
Ubl_ubiquitin 77..152 CDD:340501 7/39 (18%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
AT5G16090NP_197113.4 Ubl_Rad23 1..74 CDD:340503 24/72 (33%)
rad23 <79..171 CDD:273167 8/57 (14%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.