DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and AT4G05270

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_192436.1 Gene:AT4G05270 / 825875 AraportID:AT4G05270 Length:129 Species:Arabidopsis thaliana


Alignment Length:70 Identity:24/70 - (34%)
Similarity:35/70 - (50%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAG-KQLEDGRTLSDYNIQKE 64
            |:..|:.|.|.:..|||:..||:..||.||:..:.||..:|.||..| ..|.:..|:....|...
plant     1 MKFLVENLNGSSFELEVDYRDTLLVVKQKIERSQHIPVSKQTLIVDGIVILREDLTVEQCQIVPT 65

  Fly    65 STLHL 69
            |.:.|
plant    66 SDIQL 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 24/70 (34%)
Ubl_ubiquitin 77..152 CDD:340501
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
AT4G05270NP_192436.1 ubiquitin 3..73 CDD:459726 23/68 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.