DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and PI4K GAMMA 4

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_566076.1 Gene:PI4K GAMMA 4 / 819260 AraportID:AT2G46500 Length:566 Species:Arabidopsis thaliana


Alignment Length:52 Identity:14/52 - (26%)
Similarity:25/52 - (48%) Gaps:13/52 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 DLLGS--ADSIQKGAEGSLGGKFETVVALDDFAYKSHFKEGKSCKIEKNGQY 96
            |||.:  ::|....|:.|:.         |||.::|...||:  :::|...|
plant   247 DLLPNTRSESSSHSADYSMA---------DDFFFQSDSSEGQ--QVQKQQLY 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 7/30 (23%)
Ubl_ubiquitin 77..152 CDD:340501 5/20 (25%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
PI4K GAMMA 4NP_566076.1 Ubl1_cv_Nsp3_N-like 39..107 CDD:475130
Ubl_ubiquitin_like 115..182 CDD:340559
PI3_PI4_kinase 264..513 CDD:395364 9/35 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.