DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Uba52

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:XP_038950733.1 Gene:Uba52 / 64156 RGDID:68344 Length:169 Species:Rattus norvegicus


Alignment Length:115 Identity:85/115 - (73%)
Similarity:89/115 - (77%) Gaps:15/115 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   426 AGKQLED-----GRT-LSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA 484
            ||.:..|     |:| .||:|.:...         ..||||||||||||||||||||||||||||
  Rat    14 AGTRRSDRGAAGGKTKSSDFNYRATD---------ANMQIFVKTLTGKTITLEVEPSDTIENVKA 69

  Fly   485 KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAI 534
            ||||||||||||||||||||||||||||||||||||||||||||||||.|
  Rat    70 KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGII 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501
Ubl_ubiquitin 77..152 CDD:340501
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501 8/35 (23%)
Ubl_ubiquitin 457..532 CDD:340501 74/74 (100%)
Uba52XP_038950733.1 Ubl_ubiquitin 42..117 CDD:340501 74/74 (100%)
Ribosomal_L40e 120..167 CDD:395807 85/115 (74%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.