DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and RAD23A

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_005044.1 Gene:RAD23A / 5886 HGNCID:9812 Length:363 Species:Homo sapiens


Alignment Length:115 Identity:33/115 - (28%)
Similarity:57/115 - (49%) Gaps:17/115 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IFVKTLTGKTITLEVEPSDTIENVKAKIQDKEG---IPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64
            |.:|||..:|..:.:||.:|::.:|.||:.::|   .|...|:||:|||.|.|...:.||.|.::
Human     5 ITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEK 69

  Fly    65 STLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPP 114
            :.:.:::         .||..|:..:...|.|.|     |..:.....||
Human    70 NFVVVMV---------TKTKAGQGTSAPPEASPT-----AAPESSTSFPP 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 24/75 (32%)
Ubl_ubiquitin 77..152 CDD:340501 9/38 (24%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
RAD23ANP_005044.1 rad23 3..361 CDD:273167 33/115 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..160 7/30 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..227
HIV-1 vpr binding 319..363
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.