DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and rad23ab

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001032776.1 Gene:rad23ab / 562839 ZFINID:ZDB-GENE-051113-160 Length:404 Species:Danio rerio


Alignment Length:68 Identity:23/68 - (33%)
Similarity:42/68 - (61%) Gaps:3/68 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQD---KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQ 62
            :.|.:|||..:|..::::...|::.:|.||::   |:|.|...|:||:|||.|.|...|.:|.|.
Zfish     2 LTITLKTLQQQTFKVQIDEELTVKALKEKIEEEKGKDGFPAVGQKLIYAGKILNDDIPLKEYKID 66

  Fly    63 KES 65
            :::
Zfish    67 EKN 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 23/68 (34%)
UBQ 1..72 CDD:214563 23/68 (34%)
Ubiquitin 77..152 CDD:176398
UBQ 77..148 CDD:214563
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
rad23abNP_001032776.1 rad23 2..402 CDD:273167 23/68 (34%)
UBQ 2..79 CDD:294102 23/68 (34%)
PBP_N 56..>133 CDD:293698 4/14 (29%)
UBA1_HR23B 194..239 CDD:270609
XPC-binding 287..340 CDD:286376
UBA2_Rad23 360..398 CDD:270563
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.