DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and mrpl3

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001016594.1 Gene:mrpl3 / 549348 XenbaseID:XB-GENE-945435 Length:341 Species:Xenopus tropicalis


Alignment Length:37 Identity:12/37 - (32%)
Similarity:15/37 - (40%) Gaps:3/37 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 GSLGGKFETVVALDD---FAYKSHFKEGKSCKIEKNG 94
            |||......::.|||   ....||.||.....:.|.|
 Frog   130 GSLYQGVCKLLRLDDLFILVEPSHKKEHYLSSVNKTG 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 6/17 (35%)
Ubl_ubiquitin 77..152 CDD:340501 6/18 (33%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
mrpl3NP_001016594.1 Ribosomal_L3 50..332 CDD:481189 12/37 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.