DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and CG7215

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_650680.1 Gene:CG7215 / 3772662 FlyBaseID:FBgn0038571 Length:130 Species:Drosophila melanogaster


Alignment Length:151 Identity:42/151 - (27%)
Similarity:74/151 - (49%) Gaps:30/151 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDY-NIQKE 64
            |||.:|.|.||..|:||.|:.||..||.:|:.:..|....|:|:..|:.|.:.:|::.| ||::.
  Fly     1 MQITIKVLKGKDCTIEVAPTSTILEVKHQIEAELQISATNQKLLLLGRPLNNEQTIASYPNIKEG 65

  Fly    65 STLHLV-----LR---LRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIF 121
            :.|:||     ||   |||..:.:.:.|.      |...::.:.:.:.||.:             
  Fly    66 TKLNLVVIKPCLRDSILRGFRKHYSEPLA------ERMTNEFMADFERKINE------------- 111

  Fly   122 AGKQLEDGRTLSDYNIQKEST 142
              :.|:|...|:|..:.:.:|
  Fly   112 --QSLDDLERLADSIVNRAAT 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 32/83 (39%)
Ubl_ubiquitin 77..152 CDD:340501 9/66 (14%)
Ubl_ubiquitin 153..228 CDD:340501
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
CG7215NP_650680.1 Ubl1_cv_Nsp3_N-like 1..72 CDD:475130 27/70 (39%)
Tugs 87..121 CDD:465528 6/54 (11%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.