DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Oasl2

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001009682.1 Gene:Oasl2 / 304549 RGDID:1307351 Length:511 Species:Rattus norvegicus


Alignment Length:178 Identity:46/178 - (25%)
Similarity:82/178 - (46%) Gaps:20/178 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 TLSDYNIQKESTLHLVLRLRGG--MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGI----- 112
            |...:|:| .|..|.   |||.  :|:.||....:...|...|...|..:||||:.:..:     
  Rat   339 TADRWNVQ-V
SIAHY---LRGARDVQVTVKQTGREEWILLTNPHSPIRKLKAKIKKRMNLCGELR 399

  Fly   113 ----PPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSD 173
                .|..:|...:|:     :|||||.|..:..:.::......:|:||:...|:.....::|..
  Rat   400 ISFQEPGGERQPLSGR-----KTLSDYGIFSKVNIRVM
ETFPPEIQVFVRYPGGQNKPFAIDPDA 459

  Fly   174 TIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHL 221
            ||.::..||::..|...:...|:|.|::|:|...|::..|:...|:.|
  Rat   460 TILSLWEKIEEDGGPCTEDWVLLFEGEELDDDDNLAELQIKDCDTIQL 507

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 7/20 (35%)
UBQ 1..72 CDD:214563 5/16 (31%)
Ubiquitin 77..152 CDD:176398 19/83 (23%)
UBQ 77..148 CDD:214563 19/79 (24%)
Ubiquitin 153..228 CDD:176398 19/69 (28%)
UBQ 153..224 CDD:214563 19/69 (28%)
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Oasl2NP_001009682.1 NT_2-5OAS_ClassI-CCAase 29..214 CDD:143390
OAS1_C 170..347 CDD:402171 3/8 (38%)
Ubl1_OASL 359..432 CDD:340509 19/77 (25%)
Ubl2_OASL 438..509 CDD:340520 19/70 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.