DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Oas1i

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_001009680.1 Gene:Oas1i / 304507 RGDID:1359379 Length:382 Species:Rattus norvegicus


Alignment Length:96 Identity:19/96 - (19%)
Similarity:35/96 - (36%) Gaps:37/96 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 YNIQKEST---LHLVL-RLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRL 119
            ||.|.:..   ||..| |:|               .:.::|:|...|:       .|..|:..|.
  Rat   278 YNFQHQEVSNYLHTQLTRIR---------------PVILDPADPTGNI-------AGSNPEGWRR 320

  Fly   120 IFAGK----------QLEDGRTLSDYNIQKE 140
            : ||:          :.:||..:..:::..|
  Rat   321 L-AGEAAAWLRYPCFKYKDGSPVCPWDVPME 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_001284937.1 Ubiquitin 1..76 CDD:176398 8/20 (40%)
UBQ 1..72 CDD:214563 6/16 (38%)
Ubiquitin 77..152 CDD:176398 11/74 (15%)
UBQ 77..148 CDD:214563 11/74 (15%)
Ubiquitin 153..228 CDD:176398
UBQ 153..224 CDD:214563
Ubiquitin 229..304 CDD:176398
UBQ 229..300 CDD:214563
Ubiquitin 305..380 CDD:176398
UBQ 305..376 CDD:214563
Ubiquitin 381..456 CDD:176398
UBQ 381..452 CDD:214563
Ubiquitin 457..532 CDD:176398
UBQ 457..528 CDD:214563
Oas1iNP_001009680.1 NT_2-5OAS_ClassI-CCAase 29..212 CDD:143390
OAS1_C 164..348 CDD:287404 18/92 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5272
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.