DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Ubqlnl

DIOPT Version :9

Sequence 1:NP_001284937.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_941026.2 Gene:Ubqlnl / 244179 MGIID:2685336 Length:610 Species:Mus musculus


Alignment Length:78 Identity:21/78 - (26%)
Similarity:35/78 - (44%) Gaps:1/78 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 GGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK 139
            |.:::.||| .|..|...|.....:...|..:........:|..|:|.|:.|:|..|||...|..
Mouse    29 GVIRVIVKT-PGNQIIFTVADDTLVRQFKEILSAHFKCQMEQLVLVFMGRLLKDHDTLSQRGITD 92

  Fly   140 ESTLHLVLRLRGG 152
            ...:|:|::.:.|
Mouse    93 GHIIHVVIKSKHG 105

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity