DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and Ubd

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_075626.1 Gene:Ubd / 24108 MGIID:1344410 Length:162 Species:Mus musculus


Alignment Length:148 Identity:44/148 - (29%)
Similarity:74/148 - (50%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRL-- 73
            :.:|.|...:|.::.:...|:.:..:....|.|:...|.|:..|.||.|.|.||:|:||.|::  
Mouse    15 RLMTFETTENDKVKKINEHIRSQTKVSVQDQILLLDSKILKPHRKLSSYGIDKETTIHLTLKVVK 79

  Fly    74 --RGGMQIFV--KTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSD 134
              ...:.:|:  ....|:...|.|..|.::..||..|:....:.|.:|.:...||:||||:.::|
Mouse    80 PSDEELPLFLVESKNEGQRHLLRVRRSSSVAQVKEMIESVTSVIPKKQVVNCNGKKLEDGKIMAD 144

  Fly   135 YNIQKESTLHLVLRLRGG 152
            |||:..|.|.|.....||
Mouse   145 YNIKSGSLLFLTTHCTGG 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 19/68 (28%)
Ubl_ubiquitin 77..152 CDD:340501 23/76 (30%)
Ubl_ubiquitin 153..228 CDD:340501 44/148 (30%)
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
UbdNP_075626.1 Ubl1_cv_Nsp3_N-like 9..79 CDD:475130 19/63 (30%)
Ubl1_cv_Nsp3_N-like 87..156 CDD:475130 22/68 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.