DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ubi-p5E and C16C8.5

DIOPT Version :10

Sequence 1:NP_727078.1 Gene:Ubi-p5E / 326237 FlyBaseID:FBgn0086558 Length:534 Species:Drosophila melanogaster
Sequence 2:NP_494543.1 Gene:C16C8.5 / 182672 WormBaseID:WBGene00015843 Length:180 Species:Caenorhabditis elegans


Alignment Length:208 Identity:43/208 - (20%)
Similarity:80/208 - (38%) Gaps:61/208 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 DTIENVKAKIQD--KEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT 83
            |...||.:|:|.  .|...|:...|: ..:.|.|.::|....::::.:|...|:           
 Worm     2 DNSNNVMSKLQKLRLESKFPNGSTLV-ENQLLLDVKSLCAELLEEQKSLKKRLQ----------- 54

  Fly    84 LTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLED----GRTLSDYNIQKESTLH 144
                    :||.:..|||.|.|                  ::||:    |..::|.::       
 Worm    55 --------KVEENQKIENAKIK------------------EELENLKNGGNRVADNSL------- 86

  Fly   145 LVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQD-KEGIPPDQQRLIFAGKQLEDGRTL 208
                    .:|||.. ..|...:||..|..|..|:.|:.: ......:...|.:.|::|:|.|::
 Worm    87 --------FEIFVFD-DYKYHAVEVRNSYLIRYVRVKVANLLNNDLVESFNLYYGGQKLQDNRSI 142

  Fly   209 SDYNIQKESTLHL 221
            ..|||.:...::|
 Worm   143 GSYNIDQSREIYL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ubi-p5ENP_727078.1 Ubl_ubiquitin 1..76 CDD:340501 13/56 (23%)
Ubl_ubiquitin 77..152 CDD:340501 11/78 (14%)
Ubl_ubiquitin 153..228 CDD:340501 19/70 (27%)
Ubl_ubiquitin 229..304 CDD:340501
Ubl_ubiquitin 305..380 CDD:340501
Ubl_ubiquitin 381..456 CDD:340501
Ubl_ubiquitin 457..532 CDD:340501
C16C8.5NP_494543.1 UBQ 87..154 CDD:214563 18/67 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.